BYKdb

Annotate results for A0A0R1GM06

A0A0R1GM06 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1GM06
DOMAINcd28/216TSSEPSEGKSTISNNMAVTWADQGTKVVLVDADLRRPAVHRSFDVSNRMGLTNYLSGNAD
LSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSELTAEFDLVIVDAPPVNTVTD
AQLLASRIDGTVLVVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNY
YGGSYYGGY
SITEWalker A35/37GKS
SITEWalker A'55/62VLVDADLR
SITEWalker B135/141VIVDAPP
SITEY Cluster202/217YYGGNYYGGSYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MIAEQFKTIRTNIQFSSVDKQLQSILFTSSEPSEGKSTISNNMAVTWADQGTKVVLVDADLRRPAVHRSFDVSNRMGLTN
                           TSSEPSEGKSTISNNMAVTWADQGTKVVLVDADLRRPAVHRSFDVSNRMGLTN
                                  GKS                 VLVDADLR                  
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YLSGNADLSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSELTAEFDLVIVDAPPVNTVTDAQLLASRIDGTVL
YLSGNADLSAVVRETMVKDLSVITSGPVPPNPAELLGSKRIENLLSELTAEFDLVIVDAPPVNTVTDAQLLASRIDGTVL
                                                      VIVDAPP                   
       170       180       190       200       210       220   
....:....|....:....|....:....|....:....|....:....|....:....|...
VVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNYYGGSYYGGYYGTDDKK
VVPQGIADKNGVRRAKQLLETVHANILGTVMNRVTAQKSVGYYGGNYYGGSYYGGY       
                                         YYGGNYYGGSYYGGYY      
© 1998-2019