BYKdb

Annotate results for A0A0R1HGX3

A0A0R1HGX3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1HGX3
DOMAINcd62/246TSSGPSAGKSTVITNLAVTYANQGLKVLLIDADMRRPTAHQTFGLSNETGLTNCLTEKDI
DIAKAVEETPIENLYVMPAGPTPPNPSELLNTKRMDAILMAVAEQMDMVIIDTPPLISVT
DAQIVATKVDGTILVVREGVAKKGAVLKAKELLDTVHARIIGTILNDVSGSDESGYYGGY
YGYYK
SITEWalker A69/71GKS
SITEWalker A'89/96LLIDADMR
SITEWalker B170/176VIIDTPP
SITEY Cluster237/245YYGGYYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGVIKMSLFKKDKKLSTDSIDNGVGLITVTQPTSTIAEQFRTVRTNIQFSSIDKEMKVIMATSSGPSAGKSTVITNLAVT
                                                             TSSGPSAGKSTVITNLAVT
                                                                    GKS         
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YANQGLKVLLIDADMRRPTAHQTFGLSNETGLTNCLTEKDIDIAKAVEETPIENLYVMPAGPTPPNPSELLNTKRMDAIL
YANQGLKVLLIDADMRRPTAHQTFGLSNETGLTNCLTEKDIDIAKAVEETPIENLYVMPAGPTPPNPSELLNTKRMDAIL
        LLIDADMR                                                                
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAVAEQMDMVIIDTPPLISVTDAQIVATKVDGTILVVREGVAKKGAVLKAKELLDTVHARIIGTILNDVSGSDESGYYGG
MAVAEQMDMVIIDTPPLISVTDAQIVATKVDGTILVVREGVAKKGAVLKAKELLDTVHARIIGTILNDVSGSDESGYYGG
         VIIDTPP                                                            YYGG
      
....:.
YYGYYK
YYGYYK
YYGYY 
© 1998-2019