BYKdb

Annotate results for A0A0R1IBH5

A0A0R1IBH5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1IBH5
DOMAINcd58/246TSSASSEGKSTVSNNVAVTWAKQGETVVLVDADLRRPTIHKTFNVSNRVGLSSYLLGNAS
FEDVVQPTMVKNLFVITSGPIPPNPSELLGSMRNKDLINRLEDKFGLLIMDAPPANSVTD
AQVLATQVDGVVMVVPQGIAEKAGVAHAKQLLDTVHANILGVIMNRVTKEKSQGYYGGYY
SGYYGAEKE
SITEWalker A65/67GKS
SITEWalker A'85/92VLVDADLR
SITEWalker B165/171LIMDAPP
SITEY Cluster232/241YYGGYYSGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALFKKKTTKLDNYSLKNGVGLVTYDDPTSTISEQFNTIRTNIQFSSVDKKLNSILFTSSASSEGKSTVSNNVAVTWAKQ
                                                         TSSASSEGKSTVSNNVAVTWAKQ
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GETVVLVDADLRRPTIHKTFNVSNRVGLSSYLLGNASFEDVVQPTMVKNLFVITSGPIPPNPSELLGSMRNKDLINRLED
GETVVLVDADLRRPTIHKTFNVSNRVGLSSYLLGNASFEDVVQPTMVKNLFVITSGPIPPNPSELLGSMRNKDLINRLED
    VLVDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KFGLLIMDAPPANSVTDAQVLATQVDGVVMVVPQGIAEKAGVAHAKQLLDTVHANILGVIMNRVTKEKSQGYYGGYYSGY
KFGLLIMDAPPANSVTDAQVLATQVDGVVMVVPQGIAEKAGVAHAKQLLDTVHANILGVIMNRVTKEKSQGYYGGYYSGY
    LIMDAPP                                                            YYGGYYSGY
       
....:..
YGAEKEK
YGAEKE 
Y      
© 1998-2019