BYKdb

Annotate results for A0A0R1J1W2

A0A0R1J1W2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1J1W2
DOMAINcd60/251TSSAPSEGKSTVSNNVAVTWAKQGDKVILIDADLRRPTMHKTFNLSNKFGLSNYLLGNAE
LEDVVQKTMVDNLYVITSGPIPPNPSELLGSMRTKDLLVRLADKFDLLILDAPPANSVTD
AQVLATKVDGVILVIPQGIAEKSGVAHAQQALETVHANILGFVMNRVIRESTGYYGGYYG
GHYGGYYGADKK
SITEWalker A67/69GKS
SITEWalker A'87/94ILIDADLR
SITEWalker B167/173LILDAPP
SITEY Cluster233/246YYGGYYGGHYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKMKLFKGKRKKLDNYSLKHGVGLISYDDPTSTVSEQFKTIRTNIQFSSVDKKLKSILFTSSAPSEGKSTVSNNVAVTWA
                                                           TSSAPSEGKSTVSNNVAVTWA
                                                                  GKS           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQGDKVILIDADLRRPTMHKTFNLSNKFGLSNYLLGNAELEDVVQKTMVDNLYVITSGPIPPNPSELLGSMRTKDLLVRL
KQGDKVILIDADLRRPTMHKTFNLSNKFGLSNYLLGNAELEDVVQKTMVDNLYVITSGPIPPNPSELLGSMRTKDLLVRL
      ILIDADLR                                                                  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADKFDLLILDAPPANSVTDAQVLATKVDGVILVIPQGIAEKSGVAHAQQALETVHANILGFVMNRVIRESTGYYGGYYGG
ADKFDLLILDAPPANSVTDAQVLATKVDGVILVIPQGIAEKSGVAHAQQALETVHANILGFVMNRVIRESTGYYGGYYGG
      LILDAPP                                                           YYGGYYGG
       250 
....:....|.
HYGGYYGADKK
HYGGYYGADKK
HYGGYY     
© 1998-2019