BYKdb

Annotate results for A0A0R1K5Z6

A0A0R1K5Z6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1K5Z6
DOMAINcd60/249TSSDPSEGKSTISNNMAVTWADQGSKVILVDADLRRPTVHKTFSVSNRKGLSNYLLGNAT
LEEIVQETVVDGLYVITSGPVPPNPAELLGSMRTQDLLVRLMDKFDLLILDAPPVNTVTD
AQVLAARVDGTILVVPQGIADKAGVLHAKEALKTVNANILGAIMNRVTEQKSGGYYGGSY
YGGYYGGYYG
SITEWalker A67/69GKS
SITEWalker A'87/94ILVDADLR
SITEWalker B167/173LILDAPP
SITEY Cluster234/248YYGGSYYGGYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAFNIFSHKKHKIDNTSLKYGIGLVTYTDPKGMISEQFKTVRTNIQFSSVDKKLKSLLFTSSDPSEGKSTISNNMAVTWA
                                                           TSSDPSEGKSTISNNMAVTWA
                                                                  GKS           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DQGSKVILVDADLRRPTVHKTFSVSNRKGLSNYLLGNATLEEIVQETVVDGLYVITSGPVPPNPAELLGSMRTQDLLVRL
DQGSKVILVDADLRRPTVHKTFSVSNRKGLSNYLLGNATLEEIVQETVVDGLYVITSGPVPPNPAELLGSMRTQDLLVRL
      ILVDADLR                                                                  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDKFDLLILDAPPVNTVTDAQVLAARVDGTILVVPQGIADKAGVLHAKEALKTVNANILGAIMNRVTEQKSGGYYGGSYY
MDKFDLLILDAPPVNTVTDAQVLAARVDGTILVVPQGIADKAGVLHAKEALKTVNANILGAIMNRVTEQKSGGYYGGSYY
      LILDAPP                                                            YYGGSYY
       250    
....:....|....
GGYYGGYYGADKHK
GGYYGGYYG     
GGYYGGYY      
© 1998-2019