BYKdb

Annotate results for A0A0R1K612

A0A0R1K612 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1K612
DOMAINcd57/241TSSEPSEGKSTVSNNFAVTCANQGSKVVLIDADLRRPTIHKTFGLDNKVGLSNYLLGNAK
LDEILQPALVRNLYIIPSGPIPPNPSELLGSVRVKDLIKELESKFDMLVLDAPPVNTVTD
TQVLATVVDGVVMVVPQGIAMKAGVRHARESLELVHAHIIGAILNRVTVQKSVYYGGEYY
GAEKK
SITEWalker A64/66GKS
SITEWalker A'84/91VLIDADLR
SITEWalker B164/170LVLDAPP
SITEY Cluster230/236YYGGEYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMFGMKKNKLDSTSQKHGVNLITYNHPQDVVAEQFRTIRTNIQFTAVDKKIKSIVFTSSEPSEGKSTVSNNFAVTCANQG
                                                        TSSEPSEGKSTVSNNFAVTCANQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKVVLIDADLRRPTIHKTFGLDNKVGLSNYLLGNAKLDEILQPALVRNLYIIPSGPIPPNPSELLGSVRVKDLIKELESK
SKVVLIDADLRRPTIHKTFGLDNKVGLSNYLLGNAKLDEILQPALVRNLYIIPSGPIPPNPSELLGSVRVKDLIKELESK
   VLIDADLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDMLVLDAPPVNTVTDTQVLATVVDGVVMVVPQGIAMKAGVRHARESLELVHAHIIGAILNRVTVQKSVYYGGEYYGAEK
FDMLVLDAPPVNTVTDTQVLATVVDGVVMVVPQGIAMKAGVRHARESLELVHAHIIGAILNRVTVQKSVYYGGEYYGAEK
   LVLDAPP                                                           YYGGEYY    
 
.
K
K

© 1998-2019