BYKdb

Annotate results for A0A0R1KG57

A0A0R1KG57 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1KG57
DOMAINcd58/245TSSEPSEGKSTVSSNIAVTWAQQNEKVLLIDADLRRPTVHQTFNVDNKKGLSNYLLGNAT
FEEIIQPTDFHNLYVITSGPIPPNPSELLGSNKIKQLFTRLSESFGLLILDAPPINTVTD
AQVLANLVDGVILVVPQGIANKAAVAHAKQALLMVHAHILGAVMNRVIRDQHYGYYGSYY
GLEKYQRK
SITEWalker A65/67GKS
SITEWalker A'85/92LLIDADLR
SITEWalker B165/171LILDAPP
SITEY Cluster230/242YGYYGSYYGLEKY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLNFKNKHKKLDNYSLHHGVGLVASDDPNGIISEQFKTIRTNIQFSSVDKPLKSILFTSSEPSEGKSTVSSNIAVTWAQQ
                                                         TSSEPSEGKSTVSSNIAVTWAQQ
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NEKVLLIDADLRRPTVHQTFNVDNKKGLSNYLLGNATFEEIIQPTDFHNLYVITSGPIPPNPSELLGSNKIKQLFTRLSE
NEKVLLIDADLRRPTVHQTFNVDNKKGLSNYLLGNATFEEIIQPTDFHNLYVITSGPIPPNPSELLGSNKIKQLFTRLSE
    LLIDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SFGLLILDAPPINTVTDAQVLANLVDGVILVVPQGIANKAAVAHAKQALLMVHAHILGAVMNRVIRDQHYGYYGSYYGLE
SFGLLILDAPPINTVTDAQVLANLVDGVILVVPQGIANKAAVAHAKQALLMVHAHILGAVMNRVIRDQHYGYYGSYYGLE
    LILDAPP                                                          YGYYGSYYGLE
      
....:.
KYQRKS
KYQRK 
KY    
© 1998-2019