BYKdb

Annotate results for A0A0R1KN07

A0A0R1KN07 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1KN07
DOMAINcd58/246TSSAPSEGKSTVSNNVAVTWAKQGETVVLVDADLRRPTIHKTFNVSNRVGLSSYLLGNAS
FEDVIQPTMVKNLFVITSGPIPPNPSELLGSMRTKDLINRLEDKFGLLIMDTPPVNTVTD
AQVLAAQIDGVIMVVPQGIAEKAGVAHAKQLLDTVHANILGVIMNRVTKEKSQGYYGGYY
GGYYGGYYG
SITEWalker A65/67GKS
SITEWalker A'85/92VLVDADLR
SITEWalker B165/171LIMDTPP
SITEY Cluster232/245YYGGYYGGYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALFKKKTTKLDNYSLKNGVGLVTYDDPTSTISEQFNTIRTNIQFSSVDKKLNSILFTSSAPSEGKSTVSNNVAVTWAKQ
                                                         TSSAPSEGKSTVSNNVAVTWAKQ
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GETVVLVDADLRRPTIHKTFNVSNRVGLSSYLLGNASFEDVIQPTMVKNLFVITSGPIPPNPSELLGSMRTKDLINRLED
GETVVLVDADLRRPTIHKTFNVSNRVGLSSYLLGNASFEDVIQPTMVKNLFVITSGPIPPNPSELLGSMRTKDLINRLED
    VLVDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KFGLLIMDTPPVNTVTDAQVLAAQIDGVIMVVPQGIAEKAGVAHAKQLLDTVHANILGVIMNRVTKEKSQGYYGGYYGGY
KFGLLIMDTPPVNTVTDAQVLAAQIDGVIMVVPQGIAEKAGVAHAKQLLDTVHANILGVIMNRVTKEKSQGYYGGYYGGY
    LIMDTPP                                                            YYGGYYGGY
       250 
....:....|.
YGGYYGAEKEK
YGGYYG     
YGGYY      
© 1998-2019