BYKdb

Annotate results for A0A0R1KQV9

A0A0R1KQV9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1KQV9
DOMAINcd57/245TSSEPSEGKSTVSNNMAVTWADQGNRVILVDSDLRRPTIHRTFDVSNRKGLTNYLSGNAS
LDEIIQPTMVQNLYVITSGPVPPNPAELLGSSRINTLIKELTDKYDLLILDAPPVNTVTD
SQLLAARVDGTILVVPQGIADKNGVRRAKKMLETVHANILGAVMNRVTAQKSEGYYGGSY
YGGGYYGAE
SITEWalker A64/66GKS
SITEWalker A'84/91ILVDSDLR
SITEWalker B164/170LILDAPP
SITEY Cluster231/242YYGGSYYGGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLFNRKKKLEDTSLKYGVGLVTYTDPSGMIAEQFKTIRTNIQFSSVDSDLKSILFTSSEPSEGKSTVSNNMAVTWADQG
                                                        TSSEPSEGKSTVSNNMAVTWADQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NRVILVDSDLRRPTIHRTFDVSNRKGLTNYLSGNASLDEIIQPTMVQNLYVITSGPVPPNPAELLGSSRINTLIKELTDK
NRVILVDSDLRRPTIHRTFDVSNRKGLTNYLSGNASLDEIIQPTMVQNLYVITSGPVPPNPAELLGSSRINTLIKELTDK
   ILVDSDLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YDLLILDAPPVNTVTDSQLLAARVDGTILVVPQGIADKNGVRRAKKMLETVHANILGAVMNRVTAQKSEGYYGGSYYGGG
YDLLILDAPPVNTVTDSQLLAARVDGTILVVPQGIADKNGVRRAKKMLETVHANILGAVMNRVTAQKSEGYYGGSYYGGG
   LILDAPP                                                            YYGGSYYGGG
       250
....:....|
YYGAEKTSKD
YYGAE     
YY        
© 1998-2019