BYKdb

Annotate results for A0A0R1L5J9

A0A0R1L5J9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1L5J9
DOMAINcd58/246TSSAVSEGKSTVSANLAVIWAQQGQKVLFIDSDLRRPTLHTTFGLLNTNGLSTALSTDID
FNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKKIYDVIILDVPPLLSVTD
TQIIAAQADGVVLVVRQGLAQKLAIKRSIELLKMVKANLLGYVLNDVAPKNGYGYGYGYG
YGYGYGYGY
SITEWalker A65/67GKS
SITEWalker A'85/92LFIDSDLR
SITEWalker B165/171IILDVPP
SITE-157/-162YFKKIY
SITEY Cluster230/248YGYGYGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNIFRRKQKKISTDTLRNGVKLITDVDPKDIVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQ
                                                         TSSAVSEGKSTVSANLAVIWAQQ
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQKVLFIDSDLRRPTLHTTFGLLNTNGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKK
GQKVLFIDSDLRRPTLHTTFGLLNTNGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKK
    LFIDSDLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IYDVIILDVPPLLSVTDTQIIAAQADGVVLVVRQGLAQKLAIKRSIELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGY
IYDVIILDVPPLLSVTDTQIIAAQADGVVLVVRQGLAQKLAIKRSIELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGY
    IILDVPP                                                          YGYGYGYGYGY
       250   
....:....|...
GYGYGYGYDNKSK
GYGYGY       
GYGYGYGY     
© 1998-2019