BYKdb

Annotate results for A0A0R1P4G8

A0A0R1P4G8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1P4G8
DOMAINcd58/249TSANVSEGKSTVAANIAVVWANTGKRVLLIDADLRRPTLHKTFNLSNQVGLTSILTADEE
TVDITSMVRGTDVNNLSVITSGPIPPNPAELLNSKRMRSLLNAVRNAFDVVILDVPPLLE
VSDTQALISQLDGVVLVVKVGQTQKIAAKRAVELTKLSKARLLGYVMNDVGRGGDSAYGY
GYGYGYGYGYGY
SITEWalker A65/67GKS
SITEWalker A'85/92LLIDADLR
SITEWalker B168/174VILDVPP
SITEY Cluster235/251YGYGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVNLFRKHSRVDNNSIHNGVKLITVAQPKSVIAEQFRTIRTNISFMGIDRPIKSLAFTSANVSEGKSTVAANIAVVWANT
                                                         TSANVSEGKSTVAANIAVVWANT
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKRVLLIDADLRRPTLHKTFNLSNQVGLTSILTADEETVDITSMVRGTDVNNLSVITSGPIPPNPAELLNSKRMRSLLNA
GKRVLLIDADLRRPTLHKTFNLSNQVGLTSILTADEETVDITSMVRGTDVNNLSVITSGPIPPNPAELLNSKRMRSLLNA
    LLIDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRNAFDVVILDVPPLLEVSDTQALISQLDGVVLVVKVGQTQKIAAKRAVELTKLSKARLLGYVMNDVGRGGDSAYGYGYG
VRNAFDVVILDVPPLLEVSDTQALISQLDGVVLVVKVGQTQKIAAKRAVELTKLSKARLLGYVMNDVGRGGDSAYGYGYG
       VILDVPP                                                            YGYGYG
       250      
....:....|....:.
YGYGYGYGYGYSTDNK
YGYGYGYGY       
YGYGYGYGYGY     
© 1998-2019