BYKdb

Annotate results for A0A0R1P7V6

A0A0R1P7V6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1P7V6
DOMAINcd58/249TSANISEGKSTVAANLAIVWAQEGKSVLLIDADMRRPTLNSTFDLTGQSGLSTVLSSDQS
EVNLNDVIQESGIEGLDLLPSGAVPPNPAELLSSQRMKVLLEAVQAQYDLVVLDVPPMLE
VTDTQTIAGSVDGVVLVVRQGVTQKAGVRRAVELLKMSHAHLLGYVMNDVVPEDDAGYGY
GYGYGYGYGYEK
SITE-81/-83GKS
SITEWalker A'85/92LLIDADMR
SITEWalker B168/174VVLDVPP
SITEY Cluster235/247YGYGYGYGYGYGY
SITEWalker A65/67GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMGIFKRKSRVDNNTMKNGAKLITVAKPKSVAAEQFRTVRTNIHFMAVDRRLKTIAFTSANISEGKSTVAANLAIVWAQE
                                                         TSANISEGKSTVAANLAIVWAQE
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKSVLLIDADMRRPTLNSTFDLTGQSGLSTVLSSDQSEVNLNDVIQESGIEGLDLLPSGAVPPNPAELLSSQRMKVLLEA
GKSVLLIDADMRRPTLNSTFDLTGQSGLSTVLSSDQSEVNLNDVIQESGIEGLDLLPSGAVPPNPAELLSSQRMKVLLEA
    LLIDADMR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQAQYDLVVLDVPPMLEVTDTQTIAGSVDGVVLVVRQGVTQKAGVRRAVELLKMSHAHLLGYVMNDVVPEDDAGYGYGYG
VQAQYDLVVLDVPPMLEVTDTQTIAGSVDGVVLVVRQGVTQKAGVRRAVELLKMSHAHLLGYVMNDVVPEDDAGYGYGYG
       VVLDVPP                                                            YGYGYG
       250   
....:....|...
YGYGYGYEKESEN
YGYGYGYEK    
YGYGYGY      
© 1998-2019