BYKdb

Annotate results for A0A0R1PAD5

A0A0R1PAD5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1PAD5
DOMAINcd56/248TSASISEGKSTVAANVAVTYAQAGHKVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAK
EVDLDEVVQDSGIADLAILPAGPTPPNPSELIGSKRMQDFISLVEDHYDMVIIDLAPVIE
VSDTQELARRLDGIILVVRQGKTQKAAIKRAVEMLNFSKAKVLGFIMNDISPDNAGYGYG
YGYGYGYGYGYGY
SITE-196/-198GKT
SITEWalker A'83/90LLIDADLR
SITEWalker B166/172VIIDLAP
SITEY Cluster232/256YGYGYGYGYGYGYGYGYGYGYGYGY
SITEWalker A63/65GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLFKKKRGTDETIKKGAKLITVADPKSPVTEQFRTIRTNINFMAVDHDIKSVAFTSASISEGKSTVAANVAVTYAQAGH
                                                       TSASISEGKSTVAANVAVTYAQAGH
                                                              GKS               
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDEVVQDSGIADLAILPAGPTPPNPSELIGSKRMQDFISLVE
KVLLIDADLRRPTVHRTFNLSNHVGLSTVISSTAKEVDLDEVVQDSGIADLAILPAGPTPPNPSELIGSKRMQDFISLVE
  LLIDADLR                                                                      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DHYDMVIIDLAPVIEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEMLNFSKAKVLGFIMNDISPDNAGYGYGYGYGY
DHYDMVIIDLAPVIEVSDTQELARRLDGIILVVRQGKTQKAAIKRAVEMLNFSKAKVLGFIMNDISPDNAGYGYGYGYGY
     VIIDLAP                                                           YGYGYGYGY
       250       260       270    
....:....|....:....|....:....|....
GYGYGYGYGYGYGYGYGYGEEDKKKKGFFSGRKK
GYGYGYGY                          
GYGYGYGYGYGYGYGY                  
© 1998-2019