BYKdb

Annotate results for A0A0R1PYT5

A0A0R1PYT5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1PYT5
DOMAINcd59/246TSALASEGKSTIAANLAVTFANEGLKTLLVDADMRRPTINTTFSIADPKGLTNYLTDHEF
DINNAIYETSVTNLLVMPSGPVPPNPSELINSHRMDELIKSLYKKLALIIFDVPPLLSVT
DAQILSTKVDGTILVVKKNFAEKEAVHRAVELLNHVGGHILGTVLNDVASENKNGYYGYY
GYYEKNKN
SITEWalker A66/68GKS
SITEWalker A'86/93LLVDADMR
SITEWalker B167/173IIFDVPP
SITEY Cluster234/241YYGYYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMWFFNKKNKELSNDTMENGVHMITAALPNSVISEQFKTLRTNIQFSNVDKKYRTLMLTSALASEGKSTIAANLAVTFAN
                                                          TSALASEGKSTIAANLAVTFAN
                                                                 GKS            
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EGLKTLLVDADMRRPTINTTFSIADPKGLTNYLTDHEFDINNAIYETSVTNLLVMPSGPVPPNPSELINSHRMDELIKSL
EGLKTLLVDADMRRPTINTTFSIADPKGLTNYLTDHEFDINNAIYETSVTNLLVMPSGPVPPNPSELINSHRMDELIKSL
     LLVDADMR                                                                   
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YKKLALIIFDVPPLLSVTDAQILSTKVDGTILVVKKNFAEKEAVHRAVELLNHVGGHILGTVLNDVASENKNGYYGYYGY
YKKLALIIFDVPPLLSVTDAQILSTKVDGTILVVKKNFAEKEAVHRAVELLNHVGGHILGTVLNDVASENKNGYYGYYGY
      IIFDVPP                                                            YYGYYGY
      
....:.
YEKNKN
YEKNKN
Y     
© 1998-2019