BYKdb

Annotate results for A0A0R1QJT2

A0A0R1QJT2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1QJT2
DOMAINcd43/234TSSGPSEGKSTISGNIAVTFANQGLRTLLVDADTRRPTVHATFSLLNERGLVTLLTSKED
LDLSEYIVPTSVDHLSVLPTGPVPPNPSELLSSKRMERLIATLAKNFDMVIFDVPPLGSV
TDAQILASKVDATVLVVPYGIAQKGAVLAAKSMLEQVDANIIGVVQNRVPEEANGYYGYY
GYYGYYGKKDKD
SITEWalker A50/52GKS
SITEWalker A'70/77LLVDADTR
SITEWalker B152/158VIFDVPP
SITEY Cluster218/228YYGYYGYYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHKGVGLITDYAPKSHISEQFRTLRTNIQYSDADHQIKTLVFTSSGPSEGKSTISGNIAVTFANQGLRTLLVDADTRRPT
                                          TSSGPSEGKSTISGNIAVTFANQGLRTLLVDADTRRPT
                                                 GKS                 LLVDADTR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VHATFSLLNERGLVTLLTSKEDLDLSEYIVPTSVDHLSVLPTGPVPPNPSELLSSKRMERLIATLAKNFDMVIFDVPPLG
VHATFSLLNERGLVTLLTSKEDLDLSEYIVPTSVDHLSVLPTGPVPPNPSELLSSKRMERLIATLAKNFDMVIFDVPPLG
                                                                       VIFDVPP  
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
SVTDAQILASKVDATVLVVPYGIAQKGAVLAAKSMLEQVDANIIGVVQNRVPEEANGYYGYYGYYGYYGKKDKDNTAAK
SVTDAQILASKVDATVLVVPYGIAQKGAVLAAKSMLEQVDANIIGVVQNRVPEEANGYYGYYGYYGYYGKKDKD     
                                                         YYGYYGYYGYY           
© 1998-2019