BYKdb

Annotate results for A0A0R1RM96

A0A0R1RM96 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1RM96
DOMAINcd60/249TSSNVSEGKSTVAANTAVTWAQQGKKVLFIDADLRRPTLHATFGLPNNQGLTNVLTNKEL
DYHDVIKTTRVENLSVLTSGPVPPNPSELLNSDRMKNYIELLKGEYDLIIFDVPPMLQVT
DTQIMAAYVDGVILVVRQGVAQQKAVTRSIELLEMVHANLLGYVMNDVASRNGYGYGYGY
GYGYGYGETK
SITEWalker A67/69GKS
SITEWalker A'87/94LFIDADLR
SITEWalker B168/174IIFDVPP
SITEY Cluster233/245YGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAIFKKQKSKNDLSTDTMENGVMLITEVTPKDVVSEQFRTIRTNVEFSAVDKEYKTLIFTSSNVSEGKSTVAANTAVTWA
                                                           TSSNVSEGKSTVAANTAVTWA
                                                                  GKS           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQGKKVLFIDADLRRPTLHATFGLPNNQGLTNVLTNKELDYHDVIKTTRVENLSVLTSGPVPPNPSELLNSDRMKNYIEL
QQGKKVLFIDADLRRPTLHATFGLPNNQGLTNVLTNKELDYHDVIKTTRVENLSVLTSGPVPPNPSELLNSDRMKNYIEL
      LFIDADLR                                                                  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKGEYDLIIFDVPPMLQVTDTQIMAAYVDGVILVVRQGVAQQKAVTRSIELLEMVHANLLGYVMNDVASRNGYGYGYGYG
LKGEYDLIIFDVPPMLQVTDTQIMAAYVDGVILVVRQGVAQQKAVTRSIELLEMVHANLLGYVMNDVASRNGYGYGYGYG
       IIFDVPP                                                          YGYGYGYG
         
....:....
YGYGYGETK
YGYGYGETK
YGYGY    
© 1998-2019