BYKdb

Annotate results for A0A0R1RSB7

A0A0R1RSB7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1RSB7
DOMAINcd57/246TSSGPFQGKSTVSANVAVTWADQGVDVLLVDADMRRPTIHQTFQVPNKRGLTALLTEDEF
DLNSTIQKTPVDHLFVLPCGVVPPNPSELLNTKKMNKLIAELTKHFDLVIFDAPPVISVT
DAQILASKVDGAILVTPQGIVEKGSIAKAKELLEVVNARILGTIMNRVKSENTGGYYGGY
YGGYYGADES
SITEWalker A64/66GKS
SITEWalker A'84/91LLVDADMR
SITEWalker B165/171VIFDAPP
SITEY Cluster232/241YYGGYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGFFRKEKKLEQDSMKEGVGLITLTEPTSVIAEQFRTIRTNIQFSSIDQKLRSVVFTSSGPFQGKSTVSANVAVTWADQG
                                                        TSSGPFQGKSTVSANVAVTWADQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDVLLVDADMRRPTIHQTFQVPNKRGLTALLTEDEFDLNSTIQKTPVDHLFVLPCGVVPPNPSELLNTKKMNKLIAELTK
VDVLLVDADMRRPTIHQTFQVPNKRGLTALLTEDEFDLNSTIQKTPVDHLFVLPCGVVPPNPSELLNTKKMNKLIAELTK
   LLVDADMR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HFDLVIFDAPPVISVTDAQILASKVDGAILVTPQGIVEKGSIAKAKELLEVVNARILGTIMNRVKSENTGGYYGGYYGGY
HFDLVIFDAPPVISVTDAQILASKVDGAILVTPQGIVEKGSIAKAKELLEVVNARILGTIMNRVKSENTGGYYGGYYGGY
    VIFDAPP                                                            YYGGYYGGY
       
....:..
YGADESK
YGADES 
Y      
© 1998-2019