BYKdb

Annotate results for A0A0R1SNN0

A0A0R1SNN0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1SNN0
DOMAINcd62/245TSAAPSEGKSTVSANLAVSWAKQDEKVILIDADLRKPTIHKTFNQSNQSGLSNYLLGSAN
LDEIVKETKVPNLYVITSGPIPPNPSEILASKRIGNLMEELQNRFDLLMFDAPPVNSVTD
AQVLATKIDGTILVTPQGVAEKHSVAHAKKLLDTVHANILGAIVNQAEIDKSSNYYGGYY
GIEQ
SITEWalker A69/71GKS
SITEWalker A'89/96ILIDADLR
SITEWalker B169/175LMFDAPP
SITEY Cluster236/241YYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMLKLFSKKNKKKQKESYSMNYGVSLLAHDDPTNVISEQFNTIRTNIQFSSVDTKLHSILFTSAAPSEGKSTVSANLAVS
                                                             TSAAPSEGKSTVSANLAVS
                                                                    GKS         
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
WAKQDEKVILIDADLRKPTIHKTFNQSNQSGLSNYLLGSANLDEIVKETKVPNLYVITSGPIPPNPSEILASKRIGNLME
WAKQDEKVILIDADLRKPTIHKTFNQSNQSGLSNYLLGSANLDEIVKETKVPNLYVITSGPIPPNPSEILASKRIGNLME
        ILIDADLR                                                                
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELQNRFDLLMFDAPPVNSVTDAQVLATKIDGTILVTPQGVAEKHSVAHAKKLLDTVHANILGAIVNQAEIDKSSNYYGGY
ELQNRFDLLMFDAPPVNSVTDAQVLATKIDGTILVTPQGVAEKHSVAHAKKLLDTVHANILGAIVNQAEIDKSSNYYGGY
        LMFDAPP                                                            YYGGY
     
....:
YGIEQ
YGIEQ
Y    
© 1998-2019