BYKdb

Annotate results for A0A0R1U203

A0A0R1U203 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1U203
DOMAINcd59/240TSSLMSEGKSTVSANVAASFAKQGLRVLLVDADLRRPTIASTFGISSPQGLTNYLTEQNF
NINNIIYETSVDNLFVMPSGPIPPNPSELIGSNKMQHLVAVLADQLDLVIFDAPPVLSVT
DAQILSTCVDGTILVTRAERSEKDAVRKAVESIKHVQGHIIGAILNDVHGSDGAYGYGYY
AK
SITEWalker A66/68GKS
SITEWalker A'86/93LLVDADLR
SITEWalker B167/173VIFDAPP
SITEY Cluster233/238YGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMAFFKKNKDKIDNTSMEKGVKLITVAEPNSVITEQFNTIRTNIQFSSVDKSFKTLMITSSLMSEGKSTVSANVAASFAK
                                                          TSSLMSEGKSTVSANVAASFAK
                                                                 GKS            
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QGLRVLLVDADLRRPTIASTFGISSPQGLTNYLTEQNFNINNIIYETSVDNLFVMPSGPIPPNPSELIGSNKMQHLVAVL
QGLRVLLVDADLRRPTIASTFGISSPQGLTNYLTEQNFNINNIIYETSVDNLFVMPSGPIPPNPSELIGSNKMQHLVAVL
     LLVDADLR                                                                   
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADQLDLVIFDAPPVLSVTDAQILSTCVDGTILVTRAERSEKDAVRKAVESIKHVQGHIIGAILNDVHGSDGAYGYGYYAK
ADQLDLVIFDAPPVLSVTDAQILSTCVDGTILVTRAERSEKDAVRKAVESIKHVQGHIIGAILNDVHGSDGAYGYGYYAK
      VIFDAPP                                                           YGYGYY  
© 1998-2019