BYKdb

Annotate results for A0A0R1UFJ0

A0A0R1UFJ0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1UFJ0
DOMAINcd58/247TSSNVSEGKSTVTANVAITWAQEGKRVLLIDADLRRSTLHTTFGVPNHHGLTTVLTSAVS
EIDLSQVIMDSGVENLDVLPAGPVPPNPSELLNSQRMTAFLDAVEPIYDIIVLDVPPLLE
VTDTQALSGKLDGVILVVRAGVTQKAAISRAVEMLKISKAHLLGYVMNDVDGEDAAYGYG
YGYGYGEEEK
SITEWalker A65/67GKS
SITEWalker A'85/92LLIDADLR
SITEWalker B168/174IVLDVPP
SITEY Cluster234/242YGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLFKRKNKKYSTDTMDNGAMLITVADPKNPVAEQFRTIRTNIHFMSVDKPLRRVAFTSSNVSEGKSTVTANVAITWAQE
                                                         TSSNVSEGKSTVTANVAITWAQE
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKRVLLIDADLRRSTLHTTFGVPNHHGLTTVLTSAVSEIDLSQVIMDSGVENLDVLPAGPVPPNPSELLNSQRMTAFLDA
GKRVLLIDADLRRSTLHTTFGVPNHHGLTTVLTSAVSEIDLSQVIMDSGVENLDVLPAGPVPPNPSELLNSQRMTAFLDA
    LLIDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VEPIYDIIVLDVPPLLEVTDTQALSGKLDGVILVVRAGVTQKAAISRAVEMLKISKAHLLGYVMNDVDGEDAAYGYGYGY
VEPIYDIIVLDVPPLLEVTDTQALSGKLDGVILVVRAGVTQKAAISRAVEMLKISKAHLLGYVMNDVDGEDAAYGYGYGY
       IVLDVPP                                                           YGYGYGY
       
....:..
GYGEEEK
GYGEEEK
GY     
© 1998-2019