BYKdb

Annotate results for A0A0R1UFP0

A0A0R1UFP0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1UFP0
DOMAINcd30/217TSAMLGEGKSTVSGNLAVEYAKEGMQVLLVDADLRRPTIHKTFGLKNHKGLSSWLANQMD
DVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRNLDLVIVDAPPILPVTD
SQLLANKVDGTVLVVRQGIAQKAAVRDAVNSLKKSQANILGTVLNDVRDGSHHGYYGYNN
GYGYYSNE
SITEWalker A37/39GKS
SITEWalker A'57/64LLVDADLR
SITEWalker B137/143VIVDAPP
SITEY Cluster204/214YYGYNNGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSVITEQIKTIRTNINFAATDHKLRTLMVTSAMLGEGKSTVSGNLAVEYAKEGMQVLLVDADLRRPTIHKTFGLKNHKGL
                             TSAMLGEGKSTVSGNLAVEYAKEGMQVLLVDADLRRPTIHKTFGLKNHKGL
                                    GKS                 LLVDADLR                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRNLDLVIVDAPPILPVTDSQLLANKVDGT
SSWLANQMDDVNDAIHPVIGNLFVMTSGPKPPNPAELLGSNKMTEFLTSATRNLDLVIVDAPPILPVTDSQLLANKVDGT
                                                        VIVDAPP                 
       170       180       190       200       210         
....:....|....:....|....:....|....:....|....:....|....:....
VLVVRQGIAQKAAVRDAVNSLKKSQANILGTVLNDVRDGSHHGYYGYNNGYGYYSNEDK
VLVVRQGIAQKAAVRDAVNSLKKSQANILGTVLNDVRDGSHHGYYGYNNGYGYYSNE  
                                           YYGYNNGYGYY     
© 1998-2019