BYKdb

Annotate results for A0A0R1US13

A0A0R1US13 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1US13
DOMAINcd58/246TSSEPSEGKSTVSNNMAVTWADQGTKVILVDADLRRPTVHKSFSVSNRAGLTNYLSQAMD
LAAVIQPTIIDNLDVISSGPIPPNPAELLGSDRVQQLIDKLSEKYDLIIFDAPPVNTVTD
SQLLAARTDGTILVVPQGIADKNGVRRAKQLLETVHANILGAVMNRVTAQKSEGYYGGSY
YGGNYGGYY
SITEWalker A65/67GKS
SITEWalker A'85/92ILVDADLR
SITEWalker B165/171IIFDAPP
SITEY Cluster232/246YYGGSYYGGNYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAWFKSRKKKLDDTSLKYGVGLVTYTDPAGQISEQFKTVRTNIQFSSLGKDLKSVLFTSSEPSEGKSTVSNNMAVTWADQ
                                                         TSSEPSEGKSTVSNNMAVTWADQ
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTKVILVDADLRRPTVHKSFSVSNRAGLTNYLSQAMDLAAVIQPTIIDNLDVISSGPIPPNPAELLGSDRVQQLIDKLSE
GTKVILVDADLRRPTVHKSFSVSNRAGLTNYLSQAMDLAAVIQPTIIDNLDVISSGPIPPNPAELLGSDRVQQLIDKLSE
    ILVDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KYDLIIFDAPPVNTVTDSQLLAARTDGTILVVPQGIADKNGVRRAKQLLETVHANILGAVMNRVTAQKSEGYYGGSYYGG
KYDLIIFDAPPVNTVTDSQLLAARTDGTILVVPQGIADKNGVRRAKQLLETVHANILGAVMNRVTAQKSEGYYGGSYYGG
    IIFDAPP                                                            YYGGSYYGG
       250 
....:....|.
NYGGYYGTDGK
NYGGYY     
NYGGYY     
© 1998-2019