BYKdb

Annotate results for A0A0R1UUC5

A0A0R1UUC5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1UUC5
DOMAINcd30/213TSAVQGEGKSTIGGNLAVEYAKKGMQVLLVDADLRRPTIHQTFGVSNQRGLSSWLSGQLV
DVNDAIHPVLDHLFVMPSGPKPPNPAELLASDKMTEFLTVATRKLDLVIVDAPPVLPVTD
ARILAGQVDGTVLVVRQNFVEKVAVRQAVNALKNARTQLLGTVLNDVDIKTNGYGYGYYG
TDTN
SITEWalker A37/39GKS
SITEWalker A'57/64LLVDADLR
SITEWalker B137/143VIVDAPP
SITEY Cluster203/208YGYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSVVTEQIKTIRTNLNYSMVGKPLKTLMITSAVQGEGKSTIGGNLAVEYAKKGMQVLLVDADLRRPTIHQTFGVSNQRGL
                             TSAVQGEGKSTIGGNLAVEYAKKGMQVLLVDADLRRPTIHQTFGVSNQRGL
                                    GKS                 LLVDADLR                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SSWLSGQLVDVNDAIHPVLDHLFVMPSGPKPPNPAELLASDKMTEFLTVATRKLDLVIVDAPPVLPVTDARILAGQVDGT
SSWLSGQLVDVNDAIHPVLDHLFVMPSGPKPPNPAELLASDKMTEFLTVATRKLDLVIVDAPPVLPVTDARILAGQVDGT
                                                        VIVDAPP                 
       170       180       190       200       210   
....:....|....:....|....:....|....:....|....:....|...
VLVVRQNFVEKVAVRQAVNALKNARTQLLGTVLNDVDIKTNGYGYGYYGTDTN
VLVVRQNFVEKVAVRQAVNALKNARTQLLGTVLNDVDIKTNGYGYGYYGTDTN
                                          YGYGYY     
© 1998-2019