BYKdb

Annotate results for A0A0R1VHW0

A0A0R1VHW0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1VHW0
DOMAINcd57/248TSSNISEGKSTVTANVGVTWAQDNKRVLMVDADLRRPTMHSTFDLDNRQGLTTLLMDQEH
VINSQDVIQATEVPNLDVLTVGPVPPNATGLLNSQRMRDLVATFEQMYDVVIIDVPPILE
VNDTQVLSSMLDGVVLVVRSGVTQKVAVKRAVEMLNISKANLLGYVMNDVASGDDDGYGY
GYGYGYGYGSVE
SITEWalker A64/66GKS
SITEWalker A'84/91LMVDADLR
SITEWalker B167/173VIIDVPP
SITEY Cluster234/244YGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLFSRKKIQSVDTMVNGANLVTLTKPQSLVAEQFRTIKTNITFMGVDHPIKALAFTSSNISEGKSTVTANVGVTWAQDN
                                                        TSSNISEGKSTVTANVGVTWAQDN
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRVLMVDADLRRPTMHSTFDLDNRQGLTTLLMDQEHVINSQDVIQATEVPNLDVLTVGPVPPNATGLLNSQRMRDLVATF
KRVLMVDADLRRPTMHSTFDLDNRQGLTTLLMDQEHVINSQDVIQATEVPNLDVLTVGPVPPNATGLLNSQRMRDLVATF
   LMVDADLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EQMYDVVIIDVPPILEVNDTQVLSSMLDGVVLVVRSGVTQKVAVKRAVEMLNISKANLLGYVMNDVASGDDDGYGYGYGY
EQMYDVVIIDVPPILEVNDTQVLSSMLDGVVLVVRSGVTQKVAVKRAVEMLNISKANLLGYVMNDVASGDDDGYGYGYGY
      VIIDVPP                                                            YGYGYGY
       250 
....:....|.
GYGYGSVEPED
GYGYGSVE   
GYGY       
© 1998-2019