BYKdb

Annotate results for A0A0R1VQ95

A0A0R1VQ95 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1VQ95
DOMAINcd53/245TSAMASEGKSIVTANLAVEFAQAGKRVVLIDADLRRSTVNRTFRIREVNRGLTNYLVRQI
DDITEVCHPTMVENLAVIPSGPTPPNPAELIGSPLMATVFDQLKQYFDLIIVDAPPILPV
TDGQILSNMVDGVILVVRQNYTDKRAVVDTKERLEQAQANILGVVLNDVRSEGHSGYYNN
GDGYYGYEYSEKK
SITEWalker A60/62GKS
SITEWalker A'80/87VLIDADLR
SITEWalker B162/168IIVDAPP
SITEY Cluster229/241YYNNGDGYYGYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFNRKNKGPEPVAPANLFTVNEPSSVIAEQVKTIRTNVSFAQQAQSLRTIMVTSAMASEGKSIVTANLAVEFAQAGKRVV
                                                    TSAMASEGKSIVTANLAVEFAQAGKRVV
                                                           GKS                 V
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIDADLRRSTVNRTFRIREVNRGLTNYLVRQIDDITEVCHPTMVENLAVIPSGPTPPNPAELIGSPLMATVFDQLKQYFD
LIDADLRRSTVNRTFRIREVNRGLTNYLVRQIDDITEVCHPTMVENLAVIPSGPTPPNPAELIGSPLMATVFDQLKQYFD
LIDADLR                                                                         
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LIIVDAPPILPVTDGQILSNMVDGVILVVRQNYTDKRAVVDTKERLEQAQANILGVVLNDVRSEGHSGYYNNGDGYYGYE
LIIVDAPPILPVTDGQILSNMVDGVILVVRQNYTDKRAVVDTKERLEQAQANILGVVLNDVRSEGHSGYYNNGDGYYGYE
 IIVDAPP                                                            YYNNGDGYYGYE
     
....:
YSEKK
YSEKK
Y    
© 1998-2019