BYKdb

Annotate results for A0A0R1WGS5

A0A0R1WGS5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1WGS5
DOMAINcd60/242TSSAPSEGKSTVSNNVAVSWAKQDKKVVLIDADLRRPTIHKTFNVSNKAGLSNYLLGTAS
LESVIQSTMVDNLFVITSGPTAPNPSELLGSKKITELFQDLTAQFDFMILDAPPVNSVTD
AQVLATKVDGVILVVPQGYADKTGVIHAKKALQTVHSNILGAIMNRTAKDKMKGYYGSQY
GGY
SITEWalker A67/69GKS
SITEWalker A'87/94VLIDADLR
SITEWalker B167/173MILDAPP
SITEY Cluster234/242YYGSQYGGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAFKLLKKKTKKLDDYSLTHGVGLVTYDDPSSVISEQFNTIRTNIQFSSVDKELNSILFTSSAPSEGKSTVSNNVAVSWA
                                                           TSSAPSEGKSTVSNNVAVSWA
                                                                  GKS           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KQDKKVVLIDADLRRPTIHKTFNVSNKAGLSNYLLGTASLESVIQSTMVDNLFVITSGPTAPNPSELLGSKKITELFQDL
KQDKKVVLIDADLRRPTIHKTFNVSNKAGLSNYLLGTASLESVIQSTMVDNLFVITSGPTAPNPSELLGSKKITELFQDL
      VLIDADLR                                                                  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TAQFDFMILDAPPVNSVTDAQVLATKVDGVILVVPQGYADKTGVIHAKKALQTVHSNILGAIMNRTAKDKMKGYYGSQYG
TAQFDFMILDAPPVNSVTDAQVLATKVDGVILVVPQGYADKTGVIHAKKALQTVHSNILGAIMNRTAKDKMKGYYGSQYG
      MILDAPP                                                            YYGSQYG
  
..
GY
GY
GY
© 1998-2019