BYKdb

Annotate results for A0A0R1WHZ1

A0A0R1WHZ1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1WHZ1
DOMAINcd60/249TSSDPSEGKSTISNNVAVTWADQGSKVILIDADLRRPTVHKTFGVSNRRGLSNYLLGNAT
LEEIVQPTVVNGLYVITSGPVPPNPAELLGSLRAKDLLVRLTDKFDLLVLDAPPVNTVTD
AQVLAARVDGTILVVPQGIADKAGVMHAKEALETVNANILGAIMNRVTEQKSGGYYGGSY
YGGYYGGYYG
SITEWalker A67/69GKS
SITEWalker A'87/94ILIDADLR
SITEWalker B167/173LVLDAPP
SITEY Cluster234/248YYGGSYYGGYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAFNLFSRRKHKIDNTSLKYGIGLVTYTDPKGMISEQFKTVRTNIQFSSVDKKLKSLLFTSSDPSEGKSTISNNVAVTWA
                                                           TSSDPSEGKSTISNNVAVTWA
                                                                  GKS           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DQGSKVILIDADLRRPTVHKTFGVSNRRGLSNYLLGNATLEEIVQPTVVNGLYVITSGPVPPNPAELLGSLRAKDLLVRL
DQGSKVILIDADLRRPTVHKTFGVSNRRGLSNYLLGNATLEEIVQPTVVNGLYVITSGPVPPNPAELLGSLRAKDLLVRL
      ILIDADLR                                                                  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TDKFDLLVLDAPPVNTVTDAQVLAARVDGTILVVPQGIADKAGVMHAKEALETVNANILGAIMNRVTEQKSGGYYGGSYY
TDKFDLLVLDAPPVNTVTDAQVLAARVDGTILVVPQGIADKAGVMHAKEALETVNANILGAIMNRVTEQKSGGYYGGSYY
      LVLDAPP                                                            YYGGSYY
       250     
....:....|....:
GGYYGGYYGTDDKKK
GGYYGGYYG      
GGYYGGYY       
© 1998-2019