BYKdb

Annotate results for A0A0R1WQI7

A0A0R1WQI7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1WQI7
DOMAINcd56/241TSSGASEGKSTVAANVAASFAKQGKKTLLVDSDLRRPTIASTFNIASTQGLTNFLTDKNF
DINEVLYPTTVENLYVMPAGPVPPNPSELIGSKRMKMLKEALTEKLDLVIFDAPPVLSVT
DAQLLSVSVDGTILVVRQGEAEKEAVKQSVDLLNHVNAKIIGTIMNDVDVTSTDGYYGYY
GYYGKE
SITEWalker A63/65GKS
SITEWalker A'83/90LLVDSDLR
SITEWalker B164/170VIFDAPP
SITEY Cluster231/238YYGYYGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFGKKKKKLDSNSMKNGVYLVTVAAPKSVDTEQFNTIRTNITFSSVDESFKSIMITSSGASEGKSTVAANVAASFAKQGK
                                                       TSSGASEGKSTVAANVAASFAKQGK
                                                              GKS               
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTLLVDSDLRRPTIASTFNIASTQGLTNFLTDKNFDINEVLYPTTVENLYVMPAGPVPPNPSELIGSKRMKMLKEALTEK
KTLLVDSDLRRPTIASTFNIASTQGLTNFLTDKNFDINEVLYPTTVENLYVMPAGPVPPNPSELIGSKRMKMLKEALTEK
  LLVDSDLR                                                                      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDLVIFDAPPVLSVTDAQLLSVSVDGTILVVRQGEAEKEAVKQSVDLLNHVNAKIIGTIMNDVDVTSTDGYYGYYGYYGK
LDLVIFDAPPVLSVTDAQLLSVSVDGTILVVRQGEAEKEAVKQSVDLLNHVNAKIIGTIMNDVDVTSTDGYYGYYGYYGK
   VIFDAPP                                                            YYGYYGYY  
 
.
E
E

© 1998-2019