BYKdb

Annotate results for A0A0R1WTI0

A0A0R1WTI0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1WTI0
DOMAINcd57/246TSSGPSQGKSTVSANVAVTWADQGVDVLLVDADMRRPTVHQTFQVPNKKGLTSLLTEETF
DLNNAIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIIELTKHFDLVVFDAPPVISVT
DAQILASKVDGTILVTPQGIAEKGAVAKSKELLEVVHARILGTIMNRVKSENTGGYYGGY
YGGYYGAEEN
SITEWalker A64/66GKS
SITEWalker A'84/91LLVDADMR
SITEWalker B165/171VVFDAPP
SITEY Cluster232/241YYGGYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLFRKEKKLDQASMKEGVGLITLTDPTSIIAEQFRTIRTNIQFSSIDQKLRSVVFTSSGPSQGKSTVSANVAVTWADQG
                                                        TSSGPSQGKSTVSANVAVTWADQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDVLLVDADMRRPTVHQTFQVPNKKGLTSLLTEETFDLNNAIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIIELTK
VDVLLVDADMRRPTVHQTFQVPNKKGLTSLLTEETFDLNNAIQKTPVDHLFVLPCGVVPPNPSELLNTKKMDKLIIELTK
   LLVDADMR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HFDLVVFDAPPVISVTDAQILASKVDGTILVTPQGIAEKGAVAKSKELLEVVHARILGTIMNRVKSENTGGYYGGYYGGY
HFDLVVFDAPPVISVTDAQILASKVDGTILVTPQGIAEKGAVAKSKELLEVVHARILGTIMNRVKSENTGGYYGGYYGGY
    VVFDAPP                                                            YYGGYYGGY
       
....:..
YGAEENK
YGAEEN 
Y      
© 1998-2019