BYKdb

Annotate results for A0A0R1XAP5

A0A0R1XAP5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1XAP5
DOMAINcd13/204TSANVSEGKSTVTDNLAIVWAQTGQRVLLVDADLRRSTLHWTFSLDNREGLTTILTSHAH
SIDLNKIIQPSGIDNLSLLPSGPTPPNPAELLSSQRMKDFLKAARERYDMVIVDVPPMLE
VTDTQVISHNLDAVVLVVNQGQTQKLGAKRAVELLKMAHANLLGYVMNDVVSDGGAGYGY
GYGYGYGYGYGN
SITEWalker A20/22GKS
SITEWalker A'40/47LLVDADLR
SITEWalker B123/129VIVDVPP
SITEY Cluster190/202YGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAIDHPIKTLALTSANVSEGKSTVTDNLAIVWAQTGQRVLLVDADLRRSTLHWTFSLDNREGLTTILTSHAHSIDLNKII
            TSANVSEGKSTVTDNLAIVWAQTGQRVLLVDADLRRSTLHWTFSLDNREGLTTILTSHAHSIDLNKII
                   GKS                 LLVDADLR                                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QPSGIDNLSLLPSGPTPPNPAELLSSQRMKDFLKAARERYDMVIVDVPPMLEVTDTQVISHNLDAVVLVVNQGQTQKLGA
QPSGIDNLSLLPSGPTPPNPAELLSSQRMKDFLKAARERYDMVIVDVPPMLEVTDTQVISHNLDAVVLVVNQGQTQKLGA
                                          VIVDVPP                               
       170       180       190       200         
....:....|....:....|....:....|....:....|....:....
KRAVELLKMAHANLLGYVMNDVVSDGGAGYGYGYGYGYGYGYGNDGDDK
KRAVELLKMAHANLLGYVMNDVVSDGGAGYGYGYGYGYGYGYGN     
                             YGYGYGYGYGYGY       
© 1998-2019