BYKdb

Annotate results for A0A0R1Y5I1

A0A0R1Y5I1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1Y5I1
DOMAINcd58/249TSANVSEGKSTVTDNLAVVWAQNGQKVLLVDADLRRSTLHRTFDLDNREGLTTILTSHAR
TIDLNKIIQPSGIENLSVLPSGPTPPNPAELLSSQRMKDFLKAAKERYDMVIVDVPPMLE
VTDTQVISHYLDAVVLVVKQGQTQKLGAKRAVELLKLAHANLLGYVMNDVPSDGSADYGY
GYGYGYGYGDDG
SITEWalker A65/67GKS
SITEWalker A'85/92LLVDADLR
SITEWalker B168/174VIVDVPP
SITEY Cluster235/245YGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLFHRGNKNQANAKINNGAQLITAVHLKSPISEQFRTLRTNINFMAIDNPIKTLALTSANVSEGKSTVTDNLAVVWAQN
                                                         TSANVSEGKSTVTDNLAVVWAQN
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQKVLLVDADLRRSTLHRTFDLDNREGLTTILTSHARTIDLNKIIQPSGIENLSVLPSGPTPPNPAELLSSQRMKDFLKA
GQKVLLVDADLRRSTLHRTFDLDNREGLTTILTSHARTIDLNKIIQPSGIENLSVLPSGPTPPNPAELLSSQRMKDFLKA
    LLVDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKERYDMVIVDVPPMLEVTDTQVISHYLDAVVLVVKQGQTQKLGAKRAVELLKLAHANLLGYVMNDVPSDGSADYGYGYG
AKERYDMVIVDVPPMLEVTDTQVISHYLDAVVLVVKQGQTQKLGAKRAVELLKLAHANLLGYVMNDVPSDGSADYGYGYG
       VIVDVPP                                                            YGYGYG
       250  
....:....|..
YGYGYGDDGDDK
YGYGYGDDG   
YGYGY       
© 1998-2019