BYKdb

Annotate results for A0A0R1YC58

A0A0R1YC58 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1YC58
DOMAINcd56/248TSANISEGKSTVTANVAITYAQSGLKTLLIDGDLRRPTLHSTFNVRNNRGLTTVLTSEAK
EINLEDVVEESGVENLSILTSGPIPPNPAELIGSHRMRTFIDLVKAHYDLVIIDLAPVLE
VSDTQELASHLDGIVLVVRQGKTQKPAIKRAVDMLTFAKVRILGYVMNDVSSENAGYGYG
YGYGYGYGYGETN
SITE-196/-198GKT
SITEWalker A'83/90LLIDGDLR
SITEWalker B166/172VIIDLAP
SITEY Cluster232/244YGYGYGYGYGYGY
SITEWalker A63/65GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALFRRKRGTTETMKKGAKLITVANPQSPVSEQFRTVRTNINFMAVDHDIKTMAFTSANISEGKSTVTANVAITYAQSGL
                                                       TSANISEGKSTVTANVAITYAQSGL
                                                              GKS               
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTLLIDGDLRRPTLHSTFNVRNNRGLTTVLTSEAKEINLEDVVEESGVENLSILTSGPIPPNPAELIGSHRMRTFIDLVK
KTLLIDGDLRRPTLHSTFNVRNNRGLTTVLTSEAKEINLEDVVEESGVENLSILTSGPIPPNPAELIGSHRMRTFIDLVK
  LLIDGDLR                                                                      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AHYDLVIIDLAPVLEVSDTQELASHLDGIVLVVRQGKTQKPAIKRAVDMLTFAKVRILGYVMNDVSSENAGYGYGYGYGY
AHYDLVIIDLAPVLEVSDTQELASHLDGIVLVVRQGKTQKPAIKRAVDMLTFAKVRILGYVMNDVSSENAGYGYGYGYGY
     VIIDLAP                                                           YGYGYGYGY
       250         
....:....|....:....
GYGYGETNKKKGFLSRFKK
GYGYGETN           
GYGY               
© 1998-2019