BYKdb

Annotate results for A0A0R1YL91

A0A0R1YL91 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1YL91
DOMAINcd55/242TSTVASEGKSTIAANLAVEFAHAGKNTLLIDTDLRRSTVDRTFGMHGTTKGLTSYLVHRF
EELTDVIHETEVENLSVIPSGPIPPNPAELIASQGMKDVLTQLKESFDLVIVDAPPLLPV
TDGQIMSNMVDGVVLVVRQNHTLKAGVKEAKQTLENAKANILGVVFNDVESSNDSGYYGE
GHYDNNEQ
SITEWalker A62/64GKS
SITEWalker A'82/89LLIDTDLR
SITEWalker B164/170VIVDAPP
SITEY Cluster231/237YYGEGHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAIFKKKSNGLQPVAAANLFTLNNPSAVATEQIKTIRTNISFSQEAQNLQTIMITSTVASEGKSTIAANLAVEFAHAGKN
                                                      TSTVASEGKSTIAANLAVEFAHAGKN
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLLIDTDLRRSTVDRTFGMHGTTKGLTSYLVHRFEELTDVIHETEVENLSVIPSGPIPPNPAELIASQGMKDVLTQLKES
TLLIDTDLRRSTVDRTFGMHGTTKGLTSYLVHRFEELTDVIHETEVENLSVIPSGPIPPNPAELIASQGMKDVLTQLKES
 LLIDTDLR                                                                       
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDLVIVDAPPLLPVTDGQIMSNMVDGVVLVVRQNHTLKAGVKEAKQTLENAKANILGVVFNDVESSNDSGYYGEGHYDNN
FDLVIVDAPPLLPVTDGQIMSNMVDGVVLVVRQNHTLKAGVKEAKQTLENAKANILGVVFNDVESSNDSGYYGEGHYDNN
   VIVDAPP                                                            YYGEGHY   
  
..
EQ
EQ

© 1998-2019