BYKdb

Annotate results for A0A0R1Z021

A0A0R1Z021 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1Z021
DOMAINcd39/227TSSAVSEGKSTVSANLAVIWAQQGQKVLFIDSDLRRPTLHTTFGLLNTNGLSTALSTDID
FNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKKIYDVIILDVPPLLSVTD
TQIIAAQVDGVVLVVRQGLAQKLAIKRSTELLKMVKANLLGYVLNDVAPKNGYGYGYGYG
YGYGYGYGY
SITEWalker A46/48GKS
SITEWalker A'66/73LFIDSDLR
SITEWalker B146/152IILDVPP
SITE-138/-143YFKKIY
SITEY Cluster211/227YGYGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKLITDVDPKDVVSEQFRTVRTNINFSAVNQKLKTIIFTSSAVSEGKSTVSANLAVIWAQQGQKVLFIDSDLRRPTLHTT
                                      TSSAVSEGKSTVSANLAVIWAQQGQKVLFIDSDLRRPTLHTT
                                             GKS                 LFIDSDLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FGLLNTNGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKKIYDVIILDVPPLLSVTDTQ
FGLLNTNGLSTALSTDIDFNSVVQKTEIDNLSVITSGPIPPNPSDLLASNRMKELISYFKKIYDVIILDVPPLLSVTDTQ
                                                                 IILDVPP        
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
IIAAQVDGVVLVVRQGLAQKLAIKRSTELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGYGYGYGYDNEGK
IIAAQVDGVVLVVRQGLAQKLAIKRSTELLKMVKANLLGYVLNDVAPKNGYGYGYGYGYGYGYGYGY     
                                                  YGYGYGYGYGYGYGYGY     
© 1998-2019