BYKdb

Annotate results for A0A0R1ZIE9

A0A0R1ZIE9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R1ZIE9
DOMAINcd60/248TSPEMSDGKSTVAANVAVTWAQAGKKVLLVDADMRRPTVHLTFNSANTQGLSTILAGNKL
PEEVITDSFVDNLAVLTAGPVPPNPSELLGSKHMHQFVEWARANYDIVILDATPVLAVSD
VQVSLPEVDGTVLVVRMEKTLRGNIQRTVEVLKMADAKILGVVERVKNGRGDKGYGYGYG
YGYGYGYGY
SITEWalker A67/69GKS
SITEWalker A'87/94LLVDADMR
SITEWalker B167/173VILDATP
SITEY Cluster234/248YGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKIFKNKHKQESDESITNGVRLITAYQPKHTISEQLRTVRTNIEFAGAALDELKVVMFTSPEMSDGKSTVAANVAVTWA
                                                           TSPEMSDGKSTVAANVAVTWA
                                                                  GKS           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QAGKKVLLVDADMRRPTVHLTFNSANTQGLSTILAGNKLPEEVITDSFVDNLAVLTAGPVPPNPSELLGSKHMHQFVEWA
QAGKKVLLVDADMRRPTVHLTFNSANTQGLSTILAGNKLPEEVITDSFVDNLAVLTAGPVPPNPSELLGSKHMHQFVEWA
      LLVDADMR                                                                  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RANYDIVILDATPVLAVSDVQVSLPEVDGTVLVVRMEKTLRGNIQRTVEVLKMADAKILGVVERVKNGRGDKGYGYGYGY
RANYDIVILDATPVLAVSDVQVSLPEVDGTVLVVRMEKTLRGNIQRTVEVLKMADAKILGVVERVKNGRGDKGYGYGYGY
      VILDATP                                                            YGYGYGY
       250  
....:....|..
GYGYGYGYGSDK
GYGYGYGY    
GYGYGYGY    
© 1998-2019