BYKdb

Annotate results for A0A0R2A997

A0A0R2A997 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2A997
DOMAINcd57/243TSSNMSEGKSTVSANIATAFAKQGLHTLLVDSDLRRPTINATFGIDNPQGLSNYLSERSF
DVNKIIYKTSVKNLYVMPSGPIPPNPSELIGSKRMAELIKKLSEQLDLVIFDAPPVLSVT
DAQIVSTNVDGTILVVRANKTEKAAVKEAVRLIKQVGGHIIGTVLNDVEVKGSGYYGYYG
YSKDSKK
SITEWalker A64/66GKS
SITEWalker A'84/91LLVDSDLR
SITEWalker B165/171VIFDAPP
SITEY Cluster231/237YYGYYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MGLFRKNKNQDANTMETGVKMITVTDPTSVDTEQFNTIRTNIKFSNVDKDYKTLMITSSNMSEGKSTVSANIATAFAKQG
                                                        TSSNMSEGKSTVSANIATAFAKQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LHTLLVDSDLRRPTINATFGIDNPQGLSNYLSERSFDVNKIIYKTSVKNLYVMPSGPIPPNPSELIGSKRMAELIKKLSE
LHTLLVDSDLRRPTINATFGIDNPQGLSNYLSERSFDVNKIIYKTSVKNLYVMPSGPIPPNPSELIGSKRMAELIKKLSE
   LLVDSDLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLDLVIFDAPPVLSVTDAQIVSTNVDGTILVVRANKTEKAAVKEAVRLIKQVGGHIIGTVLNDVEVKGSGYYGYYGYSKD
QLDLVIFDAPPVLSVTDAQIVSTNVDGTILVVRANKTEKAAVKEAVRLIKQVGGHIIGTVLNDVEVKGSGYYGYYGYSKD
    VIFDAPP                                                           YYGYYGY   
     
....:
SKKKK
SKK  

© 1998-2019