BYKdb

Annotate results for A0A0R2BAC2

A0A0R2BAC2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2BAC2
DOMAINcd73/256TSSGMSEGKSTVSANTAVTWAQQGKKILFIDADLRRPSVQSSFDLVNGRGLSSVLSNNLD
FHEVTQQTAIDNLEVITSGPIPPNPAELLNSNRMKRLLDSVEAEYDLVLLDVPPLLSVTD
TQVLAARVDGVVLVVRQGVAQKTAITRAVELLQMVHANLLGYVLNDMVPRDGYGYGYGYG
YGHE
SITEWalker A80/82GKS
SITEWalker A'100/107LFIDADLR
SITEWalker B180/186VLLDVPP
SITEY Cluster245/253YGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKNGQDVGYGYKRVKTMALFRRKKKQSDDSIINGVKLVTAVEPKNVVSEQFRTVRTNIDFSSVDKQIKTLLFTSSGMSEG
                                                                        TSSGMSEG
                                                                               G
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSTVSANTAVTWAQQGKKILFIDADLRRPSVQSSFDLVNGRGLSSVLSNNLDFHEVTQQTAIDNLEVITSGPIPPNPAEL
KSTVSANTAVTWAQQGKKILFIDADLRRPSVQSSFDLVNGRGLSSVLSNNLDFHEVTQQTAIDNLEVITSGPIPPNPAEL
KS                 LFIDADLR                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNSNRMKRLLDSVEAEYDLVLLDVPPLLSVTDTQVLAARVDGVVLVVRQGVAQKTAITRAVELLQMVHANLLGYVLNDMV
LNSNRMKRLLDSVEAEYDLVLLDVPPLLSVTDTQVLAARVDGVVLVVRQGVAQKTAITRAVELLQMVHANLLGYVLNDMV
                   VLLDVPP                                                      
       250      
....:....|....:.
PRDGYGYGYGYGYGHE
PRDGYGYGYGYGYGHE
    YGYGYGYGY   
© 1998-2019