BYKdb

Annotate results for A0A0R2CCB5

A0A0R2CCB5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2CCB5
DOMAINcd60/248TSAAISEGKSTVSNNVAVAWAQSGKRVLLIDADLRRPTVHATFDLLNTDGLTNVLAGNVK
VEDAVKDTFVPNLAVMNAGPVPPNPSELLNSQKMADLLAWAREHYDIVVLDVPPVLAVSD
VQVLVPETDGVVLVVRMEHTLKGDLERTVEVLRMAHAKVLGVVERVHSKHGDRGYGYGYG
YGYGYGNDS
SITEWalker A67/69GKS
SITEWalker A'87/94LLIDADLR
SITEWalker B167/173VVLDVPP
SITEY Cluster234/244YGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRIPFFHKHYKEDMTFQTHGVRLVTYADPKHVVSEQFRTVRTNIEFAGAALDKLQVVMFTSAAISEGKSTVSNNVAVAWA
                                                           TSAAISEGKSTVSNNVAVAWA
                                                                  GKS           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSGKRVLLIDADLRRPTVHATFDLLNTDGLTNVLAGNVKVEDAVKDTFVPNLAVMNAGPVPPNPSELLNSQKMADLLAWA
QSGKRVLLIDADLRRPTVHATFDLLNTDGLTNVLAGNVKVEDAVKDTFVPNLAVMNAGPVPPNPSELLNSQKMADLLAWA
      LLIDADLR                                                                  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REHYDIVVLDVPPVLAVSDVQVLVPETDGVVLVVRMEHTLKGDLERTVEVLRMAHAKVLGVVERVHSKHGDRGYGYGYGY
REHYDIVVLDVPPVLAVSDVQVLVPETDGVVLVVRMEHTLKGDLERTVEVLRMAHAKVLGVVERVHSKHGDRGYGYGYGY
      VVLDVPP                                                            YGYGYGY
         
....:....
GYGYGNDSK
GYGYGNDS 
GYGY     
© 1998-2019