BYKdb

Annotate results for A0A0R2CUI0

A0A0R2CUI0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2CUI0
DOMAINcd60/248TSALASEGKSTVAANLAVTFADQGLKTLLVDADMRRPTINATFSIANPMGLTNYLTDHKF
DINNAIYETSVTNLFVMPSGPVPPNPSELINSRRMDGLIKSMSEQLELVIFDAPPVLSVT
DAQILSTKVDGTILVVKENFAEKEAVRRAVDLLKHVNGHILGSVLNDVTSEGGKGYYGYY
DYYGKDTEK
SITEWalker A67/69GKS
SITEWalker A'87/94LLVDADMR
SITEWalker B168/174VIFDAPP
SITEY Cluster235/242YYGYYDYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMMRIFNKKNKELSNDTMENGVHMITAAAPSSVISEQFKTLRTNIQFSNADKKYRTLMLTSALASEGKSTVAANLAVTFA
                                                           TSALASEGKSTVAANLAVTFA
                                                                  GKS           
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DQGLKTLLVDADMRRPTINATFSIANPMGLTNYLTDHKFDINNAIYETSVTNLFVMPSGPVPPNPSELINSRRMDGLIKS
DQGLKTLLVDADMRRPTINATFSIANPMGLTNYLTDHKFDINNAIYETSVTNLFVMPSGPVPPNPSELINSRRMDGLIKS
      LLVDADMR                                                                  
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSEQLELVIFDAPPVLSVTDAQILSTKVDGTILVVKENFAEKEAVRRAVDLLKHVNGHILGSVLNDVTSEGGKGYYGYYD
MSEQLELVIFDAPPVLSVTDAQILSTKVDGTILVVKENFAEKEAVRRAVDLLKHVNGHILGSVLNDVTSEGGKGYYGYYD
       VIFDAPP                                                            YYGYYD
       250 
....:....|.
YYGKDTEKDKK
YYGKDTEK   
YY         
© 1998-2019