BYKdb

Annotate results for A0A0R2D7Z0

A0A0R2D7Z0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2D7Z0
DOMAINcd57/246TSANPSEGKSTVSSNVAVTWADQGSKVLFIDADLRRSTAHRTFRVSNTHGLTTILTAKQA
DLNESIKKTEVNNLYVLPSGPVPPNPSELLNSSKMDQLLKALVDQFDMIILDAPPVNTAT
DAQVLASRVDGVILVVPQGVALKGAVLRARDLLEKVHANVLGTILNRAVDTDSGGYYGGY
YGGYYGGYYG
SITEWalker A64/66GKS
SITEWalker A'84/91LFIDADLR
SITEWalker B165/171IILDAPP
SITEY Cluster232/245YYGGYYGGYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLFRKKKKLDSHSMKHGVGLITVTKPNSTIAEQFRTIRTNIQFSSADRQLKTIIFTSANPSEGKSTVSSNVAVTWADQG
                                                        TSANPSEGKSTVSSNVAVTWADQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKVLFIDADLRRSTAHRTFRVSNTHGLTTILTAKQADLNESIKKTEVNNLYVLPSGPVPPNPSELLNSSKMDQLLKALVD
SKVLFIDADLRRSTAHRTFRVSNTHGLTTILTAKQADLNESIKKTEVNNLYVLPSGPVPPNPSELLNSSKMDQLLKALVD
   LFIDADLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QFDMIILDAPPVNTATDAQVLASRVDGVILVVPQGVALKGAVLRARDLLEKVHANVLGTILNRAVDTDSGGYYGGYYGGY
QFDMIILDAPPVNTATDAQVLASRVDGVILVVPQGVALKGAVLRARDLLEKVHANVLGTILNRAVDTDSGGYYGGYYGGY
    IILDAPP                                                            YYGGYYGGY
       250 
....:....|.
YGGYYGTDDKK
YGGYYG     
YGGYY      
© 1998-2019