BYKdb

Annotate results for A0A0R2DXC3

A0A0R2DXC3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2DXC3
DOMAINcd64/250TSPSMSEGKSTVSANVAVTWAQAGEKVLLIDADLRRPTVHATFRTLNLEGVTTVLTGKTK
PSDVVEKTFVDNLDIITSGPVPPNPSELLNSKRMANLLEWGRANYDIIVLDAPPVLAVSD
VQVLVPKTDGVVVVTNMGKTLKGDLKRTVEVLKLAKAKILGSVERVRATKGDRSYGYGYG
YGYQSND
SITE-120/-122GKT
SITEWalker A'91/98LLIDADLR
SITEWalker B171/177IVLDAPP
SITEY Cluster238/246YGYGYGYGY
SITE-201/-203GKT
SITEWalker A71/73GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLNGIFKKFTHRDEEDNETQKNGVMLVTFAEPKHVVAEQFRTVRTNIEFAGAALDRCEVVMFTSPSMSEGKSTVSANVA
                                                               TSPSMSEGKSTVSANVA
                                                                      GKS       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VTWAQAGEKVLLIDADLRRPTVHATFRTLNLEGVTTVLTGKTKPSDVVEKTFVDNLDIITSGPVPPNPSELLNSKRMANL
VTWAQAGEKVLLIDADLRRPTVHATFRTLNLEGVTTVLTGKTKPSDVVEKTFVDNLDIITSGPVPPNPSELLNSKRMANL
          LLIDADLR                                                              
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEWGRANYDIIVLDAPPVLAVSDVQVLVPKTDGVVVVTNMGKTLKGDLKRTVEVLKLAKAKILGSVERVRATKGDRSYGY
LEWGRANYDIIVLDAPPVLAVSDVQVLVPKTDGVVVVTNMGKTLKGDLKRTVEVLKLAKAKILGSVERVRATKGDRSYGY
          IVLDAPP                                                            YGY
       250  
....:....|..
GYGYGYQSNDGR
GYGYGYQSND  
GYGYGY      
© 1998-2019