BYKdb

Annotate results for A0A0R2F5X1

A0A0R2F5X1 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2F5X1
DOMAINcd57/239TSSDVSEGKSTVSANTAVTWAQQGKKVLFVDADMRRPTLHTTFGVTNTQGLSTILANNED
YHGIAVDSVVDNLTVITSGPVPPNPAELLNSNRMKNFLQTVQNEYDMVILDVPPLLSVTD
TQILSAGVDGVVLVVRQGVAQRTSVQRAVELLEMVHANLLGYVLNDVAPKNGYGYGYGYG
YEK
SITEWalker A64/66GKS
SITEWalker A'84/91LFVDADMR
SITEWalker B164/170VILDVPP
SITEY Cluster229/237YGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALFRKKKKLSTDTIDNGVKLITAVEPKNVVAEQFRTVRTNIDFSSIDKTLKTILFTSSDVSEGKSTVSANTAVTWAQQG
                                                        TSSDVSEGKSTVSANTAVTWAQQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KKVLFVDADMRRPTLHTTFGVTNTQGLSTILANNEDYHGIAVDSVVDNLTVITSGPVPPNPAELLNSNRMKNFLQTVQNE
KKVLFVDADMRRPTLHTTFGVTNTQGLSTILANNEDYHGIAVDSVVDNLTVITSGPVPPNPAELLNSNRMKNFLQTVQNE
   LFVDADMR                                                                     
       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
YDMVILDVPPLLSVTDTQILSAGVDGVVLVVRQGVAQRTSVQRAVELLEMVHANLLGYVLNDVAPKNGYGYGYGYGYEK
YDMVILDVPPLLSVTDTQILSAGVDGVVLVVRQGVAQRTSVQRAVELLEMVHANLLGYVLNDVAPKNGYGYGYGYGYEK
   VILDVPP                                                          YGYGYGYGY  
© 1998-2019