BYKdb

Annotate results for A0A0R2FT82

A0A0R2FT82 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2FT82
DOMAINcd58/241TSAEISDGKSTVAANIAITWAQAGKSVLLVDADLRRPTAHSTFDIPNTRGLTSILASDMQ
PKDLVRETFVPNLSVLQAGPVPPNPAELLGSKRMTALVNWMRNNYDMVVLDVPPVMAVTD
AQVMFKLVDGIVLVTTIGKTLKANLKRTVETISLTDAKVLGCVERVKDKSNDAGYGYGYG
YGYE
SITE-195/-197GKT
SITEWalker A'85/92LLVDADLR
SITEWalker B165/171VVLDVPP
SITEY Cluster232/240YGYGYGYGY
SITE-81/-83GKS
SITEWalker A65/67GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTFFSKKIKQDDETQRNGARLITFTEPKNIISEQFRTVKTNIEFAGAALDKLQVVMFTSAEISDGKSTVAANIAITWAQA
                                                         TSAEISDGKSTVAANIAITWAQA
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKSVLLVDADLRRPTAHSTFDIPNTRGLTSILASDMQPKDLVRETFVPNLSVLQAGPVPPNPAELLGSKRMTALVNWMRN
GKSVLLVDADLRRPTAHSTFDIPNTRGLTSILASDMQPKDLVRETFVPNLSVLQAGPVPPNPAELLGSKRMTALVNWMRN
    LLVDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NYDMVVLDVPPVMAVTDAQVMFKLVDGIVLVTTIGKTLKANLKRTVETISLTDAKVLGCVERVKDKSNDAGYGYGYGYGY
NYDMVVLDVPPVMAVTDAQVMFKLVDGIVLVTTIGKTLKANLKRTVETISLTDAKVLGCVERVKDKSNDAGYGYGYGYGY
    VVLDVPP                                                            YGYGYGYGY
 
.
E
E

© 1998-2019