BYKdb

Annotate results for A0A0R2FW20

A0A0R2FW20 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2FW20
DOMAINcd65/254TSSGPSEGKSTVSANIAVTFADQGMKTLLIDADMRRPTIHQTFQIPNRKGLTTILTSSKN
DYDSVIVKTKVANLSVMPSGPVPPNPSELLNTHKMDQIIEELSEQYDLIIFDAPPVGSVT
DAQIIGTKVDGSILVVPQGIALKGAVLQAKDALDSVHARIIGTIMNRVSRKNGTGYYGGY
YGGYYGGYYG
SITEWalker A72/74GKS
SITEWalker A'92/99LLIDADMR
SITEWalker B173/179IIFDAPP
SITEY Cluster240/253YYGGYYGGYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MANKLTTWWQNRKDKSKLDDQSMQKGVSLITVSDPKSTIAEQFRTIRTNIQFSQVDDQLRTLSFTSSGPSEGKSTVSANI
                                                                TSSGPSEGKSTVSANI
                                                                       GKS      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVTFADQGMKTLLIDADMRRPTIHQTFQIPNRKGLTTILTSSKNDYDSVIVKTKVANLSVMPSGPVPPNPSELLNTHKMD
AVTFADQGMKTLLIDADMRRPTIHQTFQIPNRKGLTTILTSSKNDYDSVIVKTKVANLSVMPSGPVPPNPSELLNTHKMD
           LLIDADMR                                                             
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QIIEELSEQYDLIIFDAPPVGSVTDAQIIGTKVDGSILVVPQGIALKGAVLQAKDALDSVHARIIGTIMNRVSRKNGTGY
QIIEELSEQYDLIIFDAPPVGSVTDAQIIGTKVDGSILVVPQGIALKGAVLQAKDALDSVHARIIGTIMNRVSRKNGTGY
            IIFDAPP                                                            Y
       250       260 
....:....|....:....|.
YGGYYGGYYGGYYGKNEDKKN
YGGYYGGYYGGYYG       
YGGYYGGYYGGYY        
© 1998-2019