BYKdb

Annotate results for A0A0R2GZ22

A0A0R2GZ22 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2GZ22
DOMAINcd58/245TSSQMSDGKSTVSSNVAVTWAQAGKKALIVDADLRRPTVHTTFRLDNRQGLTTILASDLQ
PKDLVHETMVPGLSALTSGPVPPNPAELLGSPRMAALVEWMRNNYDIVVLDVPPLNLVTD
AQVMLPLADGVVLLITLNQTQKVNLERAVELLNLTSTKVLGVVSRAKRNDGDSGYGYGYG
YGYGSTQD
SITEWalker A65/67GKS
SITEWalker A'85/92LIVDADLR
SITEWalker B165/171VVLDVPP
SITEY Cluster232/240YGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLFKRHYKEDVETQTNGARLITFTEPKNVISEQLRTVRTNIEYAGAALDKLQVVMFTSSQMSDGKSTVSSNVAVTWAQA
                                                         TSSQMSDGKSTVSSNVAVTWAQA
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GKKALIVDADLRRPTVHTTFRLDNRQGLTTILASDLQPKDLVHETMVPGLSALTSGPVPPNPAELLGSPRMAALVEWMRN
GKKALIVDADLRRPTVHTTFRLDNRQGLTTILASDLQPKDLVHETMVPGLSALTSGPVPPNPAELLGSPRMAALVEWMRN
    LIVDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NYDIVVLDVPPLNLVTDAQVMLPLADGVVLLITLNQTQKVNLERAVELLNLTSTKVLGVVSRAKRNDGDSGYGYGYGYGY
NYDIVVLDVPPLNLVTDAQVMLPLADGVVLLITLNQTQKVNLERAVELLNLTSTKVLGVVSRAKRNDGDSGYGYGYGYGY
    VVLDVPP                                                            YGYGYGYGY
     
....:
GSTQD
GSTQD

© 1998-2019