BYKdb

Annotate results for A0A0R2HET3

A0A0R2HET3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2HET3
DOMAINcd55/243TSSAPSEGKSTVSNNVAVTWADQGKRVLIVDADMRRPTVHRTFSVSNAVGLSNLLAETGS
LENAIHETIINNLSVMPSGPIPPNPSELLGSTKMAALLDQLTGAYDLVIIDAPPVNTVTD
AQVLAARADGTILVVPQGIADKAGVRHAKQLLEAVQANILGAILNRATAEKSTGYYGGYY
GGYYGTDDK
SITEWalker A62/64GKS
SITEWalker A'82/89LIVDADMR
SITEWalker B162/168VIIDAPP
SITEY Cluster229/238YYGGYYGGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKKKQKSDNESLKNGVGLVTFTDPTSTIAEQFRTVRTNIQFSSVDKALKSIVFTSSAPSEGKSTVSNNVAVTWADQGKR
                                                      TSSAPSEGKSTVSNNVAVTWADQGKR
                                                             GKS                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIVDADMRRPTVHRTFSVSNAVGLSNLLAETGSLENAIHETIINNLSVMPSGPIPPNPSELLGSTKMAALLDQLTGAYD
VLIVDADMRRPTVHRTFSVSNAVGLSNLLAETGSLENAIHETIINNLSVMPSGPIPPNPSELLGSTKMAALLDQLTGAYD
 LIVDADMR                                                                       
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LVIIDAPPVNTVTDAQVLAARADGTILVVPQGIADKAGVRHAKQLLEAVQANILGAILNRATAEKSTGYYGGYYGGYYGT
LVIIDAPPVNTVTDAQVLAARADGTILVVPQGIADKAGVRHAKQLLEAVQANILGAILNRATAEKSTGYYGGYYGGYYGT
 VIIDAPP                                                            YYGGYYGGYY  
   
...
DDK
DDK

© 1998-2019