BYKdb

Annotate results for A0A0R2HZW6

A0A0R2HZW6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2HZW6
DOMAINcd62/253TSANVSEGKSTVTDNIVVVFAQNGQHVLLVDADLRRPTLSKSFGVDNRQGLTSILTSRVQ
SIDLSQIIKPSGIQNLDVLPSGPIPPNPAELLASQRMQAFLDAVKQNYDMVILDVPPMLE
VTDTQVLSHSLDAVVMVIRQGRTQKMAARRSVELLHMAHANLLGYVMNAADSKADAGYGY
GYGYGYGYGYGY
SITEWalker A69/71GKS
SITEWalker A'89/96LLVDADLR
SITEWalker B172/178VILDVPP
SITEY Cluster239/255YGYGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSILSTLLFDRKKKNSTDTIDNGVKLITAVHPKSIISEQFRTIRTNIDFMAIDKQIRTLAFTSANVSEGKSTVTDNIVVV
                                                             TSANVSEGKSTVTDNIVVV
                                                                    GKS         
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FAQNGQHVLLVDADLRRPTLSKSFGVDNRQGLTSILTSRVQSIDLSQIIKPSGIQNLDVLPSGPIPPNPAELLASQRMQA
FAQNGQHVLLVDADLRRPTLSKSFGVDNRQGLTSILTSRVQSIDLSQIIKPSGIQNLDVLPSGPIPPNPAELLASQRMQA
        LLVDADLR                                                                
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FLDAVKQNYDMVILDVPPMLEVTDTQVLSHSLDAVVMVIRQGRTQKMAARRSVELLHMAHANLLGYVMNAADSKADAGYG
FLDAVKQNYDMVILDVPPMLEVTDTQVLSHSLDAVVMVIRQGRTQKMAARRSVELLHMAHANLLGYVMNAADSKADAGYG
           VILDVPP                                                            YG
       250       260
....:....|....:....|
YGYGYGYGYGYGYGYGEGEK
YGYGYGYGYGYGY       
YGYGYGYGYGYGYGY     
© 1998-2019