BYKdb

Annotate results for A0A0R2I6Y6

A0A0R2I6Y6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2I6Y6
DOMAINcd47/226TSPEPMSGKSTISANLAIVYAQKGKKTLLVDGDMRKPTVHKTFNQSIFKGLSTSLTGDSK
VSDNFQKTEIENLFILTSGPIPPNPNELLGSKRMGAVLKELKTQFDVIIIDSPPVTVVSD
ALVLASYTDGVLFVFRNQVTMKNKAKQAIEQIKMTRVPIIGAILNGEQEKQHNNYYYAYK
SITEWalker A54/56GKS
SITEWalker A'74/81LLVDGDMR
SITEWalker B154/160IIIDSPP
SITEY Cluster221/225YYYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNRLGDEKRRLITKMHATSSISEQFKNIRTAIEFSGVDKTFQTILITSPEPMSGKSTISANLAIVYAQKGKKTLLVDGDM
                                              TSPEPMSGKSTISANLAIVYAQKGKKTLLVDGDM
                                                     GKS                 LLVDGDM
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RKPTVHKTFNQSIFKGLSTSLTGDSKVSDNFQKTEIENLFILTSGPIPPNPNELLGSKRMGAVLKELKTQFDVIIIDSPP
RKPTVHKTFNQSIFKGLSTSLTGDSKVSDNFQKTEIENLFILTSGPIPPNPNELLGSKRMGAVLKELKTQFDVIIIDSPP
R                                                                        IIIDSPP
       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
VTVVSDALVLASYTDGVLFVFRNQVTMKNKAKQAIEQIKMTRVPIIGAILNGEQEKQHNNYYYAYK
VTVVSDALVLASYTDGVLFVFRNQVTMKNKAKQAIEQIKMTRVPIIGAILNGEQEKQHNNYYYAYK
                                                            YYYAY 
© 1998-2019