BYKdb

Annotate results for A0A0R2IQW0

A0A0R2IQW0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2IQW0
DOMAINcd54/235TSSGPGEGKSTVSANLATVFADQKHRVLLIDADLRRPSIHRVFKKPNTKGLTSLLNNPNL
SVEEVIHRSKIENLFLITSGPTPTNPSELLSSNGMDRLIKLFQKNFDLIIFDLPPTVAVT
DAQIMATKVDGTILVVRNDVAYKDAVDKAVDLLRTVGANLVGFIFNGAERKTTDPYSYYG
KD
SITEWalker A61/63GKS
SITEWalker A'81/88LLIDADLR
SITEWalker B162/168IIFDLPP
SITEY Cluster229/232YSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLNFRSKKQTRVVKAPKLITSLYPNSIISEQFRTIRSNLQFSENGMNLKTIGVTSSGPGEGKSTVSANLATVFADQKHRV
                                                     TSSGPGEGKSTVSANLATVFADQKHRV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIDADLRRPSIHRVFKKPNTKGLTSLLNNPNLSVEEVIHRSKIENLFLITSGPTPTNPSELLSSNGMDRLIKLFQKNFD
LLIDADLRRPSIHRVFKKPNTKGLTSLLNNPNLSVEEVIHRSKIENLFLITSGPTPTNPSELLSSNGMDRLIKLFQKNFD
LLIDADLR                                                                        
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
LIIFDLPPTVAVTDAQIMATKVDGTILVVRNDVAYKDAVDKAVDLLRTVGANLVGFIFNGAERKTTDPYSYYGKD
LIIFDLPPTVAVTDAQIMATKVDGTILVVRNDVAYKDAVDKAVDLLRTVGANLVGFIFNGAERKTTDPYSYYGKD
 IIFDLPP                                                            YSYY   
© 1998-2019