BYKdb

Annotate results for A0A0R2J2V6

A0A0R2J2V6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0R2J2V6
DOMAINcd57/241TSSGPGEGKSTTSANLAVVFATQGKRVLLVDADMRKPSVNKTFKLSNHEGLTTLLTEKEV
VLGDVVHETNTENLFILTSGPIPPNPSELLDSKKMNRVIEILEETFDLVIFDMPPIVSVT
DAQIMASKTDGTVFVIRNGIATKEAVLKAKQLLDIVNANVVGTIFNGLEKRKDKAYKYYG
IEGEN
SITEWalker A64/66GKS
SITEWalker A'84/91LLVDADMR
SITEWalker B165/171VIFDMPP
SITEY Cluster232/235YKYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKFKTNKEQLIESQKNGASLVTVTKPNSVVAEQFRTIRTNIQFSMIDRDLKSLIFTSSGPGEGKSTTSANLAVVFATQG
                                                        TSSGPGEGKSTTSANLAVVFATQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KRVLLVDADMRKPSVNKTFKLSNHEGLTTLLTEKEVVLGDVVHETNTENLFILTSGPIPPNPSELLDSKKMNRVIEILEE
KRVLLVDADMRKPSVNKTFKLSNHEGLTTLLTEKEVVLGDVVHETNTENLFILTSGPIPPNPSELLDSKKMNRVIEILEE
   LLVDADMR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TFDLVIFDMPPIVSVTDAQIMASKTDGTVFVIRNGIATKEAVLKAKQLLDIVNANVVGTIFNGLEKRKDKAYKYYGIEGE
TFDLVIFDMPPIVSVTDAQIMASKTDGTVFVIRNGIATKEAVLKAKQLLDIVNANVVGTIFNGLEKRKDKAYKYYGIEGE
    VIFDMPP                                                            YKYY     
 
.
N
N

© 1998-2019